PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016469436.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family B3
Protein Properties Length: 597aa    MW: 69016.2 Da    PI: 10.266
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016469436.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B349.38.7e-16203282587
                     -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
              B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87 
                     ++++++ k + l++p +fa++ g+ + ++ ++tl de+ rsW+v l     + ++ +++GW+eFv++ng++ gD+  F+l+++
  XP_016469436.1 203 TVKHYAIKYHALYFPLDFAKSTGLMN-RHCEITLVDEKRRSWSVWL--GPMGHHFGIKRGWREFVQENGVQIGDTYKFELINN 282
                     568899999**********9997774.5679***************..999999*************************9875 PP

2B336.21e-113574281799
                     E--HHH.HTT.---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
              B3  17 vlpkkfaeeh.ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                      +p  f+ ++ ++ k    +  +  + +++W vk+  ++++    +++GW eF++ +gL+ gD+++F+++g++ef   v +f++
  XP_016469436.1 357 KIPVGFL-KYlKEYK---NEHAILRRGSKQWAVKV--NGRR----FEAGWVEFAQKHGLQLGDMLIFRHEGKMEF--EVVIFDS 428
                     5788888.5533222...2456667899*******..8887....9**********************9998999..7777775 PP

3B349.29.6e-16488569587
                     -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
              B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87 
                     +++s+ l++g l+lp +fa+ +g+ + ++ +l+++d + rsW++kl+++++++ y++++G ++F  +n L+egD ++++++ +
  XP_016469436.1 488 TIRSYCLSKGFLCLPQQFAKPNGLTN-KKCDLIIRDGRQRSWNLKLSFSRRPRVYIIGDGLRKFIVDNCLEEGDRIMLEVVTN 569
                     6789******************8875.5569***********************************************97764 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.8E-4557IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.69E-19194290IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.107.3E-19194290IPR015300DNA-binding pseudobarrel domain
CDDcd100179.48E-16198292No hitNo description
PROSITE profilePS5086312.774199293IPR003340B3 DNA binding domain
SMARTSM010191.1E-15200293IPR003340B3 DNA binding domain
PfamPF023621.1E-14203283IPR003340B3 DNA binding domain
PROSITE profilePS5086311.547341429IPR003340B3 DNA binding domain
SMARTSM010199.5E-8346429IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.104.6E-16349430IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.18E-13352430IPR015300DNA-binding pseudobarrel domain
PfamPF023623.0E-8357428IPR003340B3 DNA binding domain
CDDcd100177.75E-10358427No hitNo description
Gene3DG3DSA:2.40.330.102.0E-13482577IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.12E-15483577IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS508639.742484580IPR003340B3 DNA binding domain
SMARTSM010194.7E-13485580IPR003340B3 DNA binding domain
PfamPF023626.9E-14487571IPR003340B3 DNA binding domain
CDDcd100171.10E-11489565No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 597 aa     Download sequence    Send to blast
MKKVPPMKPH FFKPILPGFK NDLKIPISFL KYLKQHEHIE HAILRRNGKK WMVKVNMALD  60
SKMVGQNLQK SMICNWEICW CLDMKADIKA SGKAFPNVEA ANKEIHISHS HLICTIRPYC  120
LSKHFLHIPR QFALDNRLNN RKYLRGSPPL HPEVKKKNMN LDAKRISDEG IRDLRIKTTD  180
ATAPKVQVPA LTSTDANPHF VSTVKHYAIK YHALYFPLDF AKSTGLMNRH CEITLVDEKR  240
RSWSVWLGPM GHHFGIKRGW REFVQENGVQ IGDTYKFELI NNGRIPIAHF HCIFWEGCQE  300
SPSEDIDKML KQLVMGKETS TEARETPARL FSLLKKNFTR SRKLTFFQIN QSVAHAKIPV  360
GFLKYLKEYK NEHAILRRGS KQWAVKVNGR RFEAGWVEFA QKHGLQLGDM LIFRHEGKME  420
FEVVIFDSSG SVREYLQEEV HTVEETSKNF EFEEKPSPSI KSSNMASSHT EAATHAKLPF  480
GQSHFVCTIR SYCLSKGFLC LPQQFAKPNG LTNKKCDLII RDGRQRSWNL KLSFSRRPRV  540
YIIGDGLRKF IVDNCLEEGD RIMLEVVTNG ETPIWRFQVV TNGGTPIRKF QGKFLIL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016469436.10.0PREDICTED: B3 domain-containing protein REM10-like
TrEMBLK4CID75e-89K4CID7_SOLLC; Uncharacterized protein
STRINGSolyc08g006490.1.11e-88(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA32215171
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24680.13e-22B3 family protein